PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA18144
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YC
Protein Properties Length: 291aa    MW: 32259.4 Da    PI: 10.2539
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA18144genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC39.21.5e-12841731099
                      NF-YC  10 iekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflv 93 
                                 e+++  k + +P++ri+ ilk +    ++s ea   + +a e f+ +l+  +++ + + +++ l  + ++ +v++   +dfl 
  Tp57577_TGAC_v2_mRNA18144  84 EENEEAAKTNVFPMSRIRTILKGEITDLRVSQEAVLAINNAAEKFLEQLAEEAYVYSVQDRKKYLSYNHLSRVVSKQSRYDFLS 167
                                56666778899*************99999******************************************************* PP

                      NF-YC  94 divprd 99 
                                d vp++
  Tp57577_TGAC_v2_mRNA18144 168 DFVPEK 173
                                ***986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471139.88E-1874171IPR009072Histone-fold
PfamPF008082.1E-1295157IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.9E-2095172IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MASSNNSIAK NNKKTKKPQT STPTSKIKKE KSIQNSKEKK KNEENNNNKN KNKKKLNFTN  60
GNSKEKQVNG KKHHKNNNDD DEKEENEEAA KTNVFPMSRI RTILKGEITD LRVSQEAVLA  120
INNAAEKFLE QLAEEAYVYS VQDRKKYLSY NHLSRVVSKQ SRYDFLSDFV PEKVKAEDAL  180
RETNLRGNRG VNLTTGIVNA TVGGTVYTDR QLAVYEVDKV LLPRDFFVAK PPAPAPAPEK  240
AKASSSKKKS ADNDVVAGDD DSTSAASVKQ RCLISVPVAV ATIIVALFSW *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182998e-96JQ918299.1 Medicago truncatula nuclear transcription factor Y subunit C7 (NF-YC7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003606405.11e-75core histone H2A/H2B/H3/H4
TrEMBLG7JPE71e-75G7JPE7_MEDTR; Core histone H2A/H2B/H3/H4
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120163031
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.12e-26nuclear factor Y, subunit C10